Cilp1 antibody

Web(A06239) Anti-CILP1 Antibody (A06239) Supplier Boster Biological Technology. Host Rabbit View Product On Supplier's Website. Add to Procurement List Product is on your … WebCD74, also known as CLIP, is a 33.5kD homotrimer and functions as a MHC class II chaperone for exogenous peptides and other MHC class II molecules. CD74 binds MIF and regulates innate and adaptive immunity through CD44 signaling. It is found primarily on B-cells, monocytes, macrophages and dendritic

CILP-1 Antibody [Unconjugated] (AF5504): Novus …

WebCited in 1 publication. View Human CILP-1 N-Terminal Fragment Antibody (AF5504) validated in Human & Simple Western, Western Blot from R&D Systems, Inc. a Bio-Techne Brand. cyyz runway length https://doddnation.com

Recombinant Anti-CILP antibody [EPR16303] - BSA and Azide free ... - Abcam

WebAntibody [NBP1-81667] CILP-1 Antibody by Novus Biologicals. Menu Sign in or Register Search; Custom Suppliers; Data; Citations; Images; Listing; Contact; ... O75339 - … WebBackground: CILP-1 The CILP-1 (cartilage intermediate-layer protein 1) gene product is a monomeric glycoprotein precursor of two secreted, proteolytically generated products, a 90 kDa N-terminal CILP-1, and a 62 kDa C-terminal NTPPHase-homolog. It is found in both hyaline and fibrocartilage. WebProduct Details. This Human CILP ELISA Kit was designed for the quantitative measurement of Human CILP protein in serum, plasma, tissue homogenates. It is a … cyyz airport weather

TotalSeq™-C1043 anti-mouse CD74 (CLIP) Antibody

Category:(A06239) Anti-CILP1 Antibody (A06239) - Boster …

Tags:Cilp1 antibody

Cilp1 antibody

CILP-1 Antibody (2C5) (H00008483-M01): Novus Biologicals

Web购物车里没有产品. Anti-MHC Class II Antibody [6C6] (ab55152) 产品货号 产品 WebHuman CILP-1 N-Terminal Fragment Biotinylated Antibody. Cat # BAF5504. Human URB Antibody. Cat # AF3410. Citations (1) Recombinant Human Protocadherin gamma C3 Protein, CF. ... (CILP1): A novel mediator of cardiac extracellular matrix remodelling Authors: FA van Nieuwe, C Munts, RC Op't Veld, A González, J Díez, S Heymans, B ...

Cilp1 antibody

Did you know?

WebAntibody [NBP1-81667] CILP-1 Antibody by Novus Biologicals. Menu Sign in or Register Search; Custom Suppliers; Data; Citations; Images; Listing; Contact; ... O75339 - CILP1_HUMAN. Gene CILP Modification Unmodified View Product On Supplier's Website Request a Quote from Novus Biologicals. WebOct 8, 2024 · In mice, the amount of RV CILP1 was markedly higher after banding than after sham. Control patients had lower CILP1 serum levels than all other groups (p<0.001). CILP1 concentrations were higher in PH patients with maladaptive RV function than those with adaptive RV function (p<0.001), LV pressure overload (p<0.001), and DCM (p=0.003).

WebMar 21, 2024 · CILP (Cartilage Intermediate Layer Protein) is a Protein Coding gene. Diseases associated with CILP include Intervertebral Disc Disease and Osteoarthritis . … WebNov 18, 2008 · The synthesis of cartilage intermediate layer protein (CILP), which was identified and purified from human articular cartilage ( Lorenzo et al., 1998 ), increases in early osteoarthrosis cartilage. By RT-PCR using human articular cartilage RNA and degenerate primers based on the amino acid sequence of CILP, and by screening a …

WebJun 1, 2005 · Background. CILP, Cartilage Intermediate Layer Protein, is specifically expressed in the articular cartilage intermediate layer (it cannot be found in the superficial nor in the deepest layers) and is involved in scaffolding. Overexpression of this protein … WebOct 6, 2024 · Rationale: Cartilage intermediate layer protein 1 (Cilp1) is a secreted extracellular matrix (ECM) protein normally associated with bone and cartilage development. Its function and mechanism of...

WebJun 1, 2024 · Cilp1 polyclonal antibody was raised in rabbits against a synthetic peptide (RQTMLAQSVRRVQPVKRTPKTLAKPADSQE) corresponding to preproCILP1 22-51, after conjugating with keyhole limpet hemocyanin via its C-terminal cysteine. Antibodies for immunofluorescence staining of 4′, 6-diamidino-2-phenylindole (DAPI) and alpha-smooth …

WebThis product is a recombinant monoclonal antibody, which offers several advantages including: - High batch-to-batch consistency and reproducibility - Improved sensitivity and specificity - Long-term security of supply - Animal-free … cyzcorp s a cWebCILP-1 HsT18872 Background Major alterations in the composition of the cartilage extracellular matrix occur in joint disease, such as osteoarthrosis. This gene encodes the cartilage intermediate layer protein (CILP), which increases in early osteoarthrosis cartilage. bingham construction springfield moWebab251162 is the carrier-free version of ab192881. Our carrier-free antibodies are typically supplied in a PBS-only formulation, purified and free of BSA, sodium azide and glycerol. … bingham construction marble fallsWebListed below are anti-CILP-1 antibodies from multiple suppliers. CILP-1 is a reported alias name for the human gene CILP, or 'cartilage intermediate layer protein'. The 1184-amino acid protein has a reported mass of 132,565 daltons. The cellular localization is predicted to be secreted. Glycosylation sites have been reported. cyy switchWebBackground. Cytoplasmic FMR1-interacting protein 1 (CYFIP1) is a component of the CYFIP1/EIF4E/FMR1 complex which mediates translational repression by binding … cy young winner dennisWebThis product is a recombinant monoclonal antibody, which offers several advantages including: - High batch-to-batch consistency and reproducibility - Improved sensitivity and … cyzerg warehouse technologyWebNov 22, 2024 · CILP1 is an extracellular matrix (ECM) protein abundant in articular cartilage 6 and has been implicated in several diseases … bingham coffee table rustic oak